DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and Ku80

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:318 Identity:64/318 - (20%)
Similarity:112/318 - (35%) Gaps:111/318 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IRRLAQEQGECPSS-------KDKVIEQFRNYI------LEHNECQPHRSDAKYLEKFLRARYWK 79
            :|..|.|:.:..|:       |||::...::|:      .:.:|.:...:....:..|...|.. 
  Fly    14 VRTCAAEEVKLKSAKCVAEILKDKIVCDRKDYVSFVLVGCDTDEIKTEDASHPNVLPFGEPRLC- 77

  Fly    80 IENSYKLLCSYYRFREQNKSFYEK-------VRPLDLRHVGQSDILTVTPYRDQHGHRILIYRFG 137
               |::||..:::|  .||:..|.       ...|:|::|       .|..|......:|::.|.
  Fly    78 ---SWQLLLEFFQF--VNKTACEDGEWLNGLQAALELQNV-------ATTLRVARRRILLLFDFN 130

  Fly   138 LW-----RPNQVTVDDIFRATIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVA---- 193
            .:     :.|::| |::         ||  |.|..|||...|     ..:::.:...|...    
  Fly   131 DFPQDYEKFNEIT-DEL---------LG--ENIELIVGTHNI-----AYIDNAITSQPQAIFNFS 178

  Fly   194 ----------QKMIALLV----TSMPIRTSALHIV-----NQNWVFNAAF--------------- 224
                      ||....||    .::.....|||.|     .:.||:||..               
  Fly   179 RKCGPDELNNQKYALSLVPRCNATLCSFKEALHTVFKVTNRRPWVWNAKLNIGSKISISLQGIIA 243

  Fly   225 ----------KIFKPFLNAAMRE-KLYIHGSDMTSLHKHINPEHLPKRY--GGLHEDY 269
                      |::.......:|| :.||.|:::|.|     ||:|...|  ||....|
  Fly   244 MKNQTPVKLVKVWAEKDEIVIRETRHYIKGTEITPL-----PENLITGYMLGGTPVPY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/52 (17%)
SEC14 112..265 CDD:238099 42/208 (20%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 44/228 (19%)
KU80 221..524 CDD:238445 19/81 (23%)
Ku_PK_bind 562..663 CDD:285938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.