DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and CG33514

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster


Alignment Length:248 Identity:71/248 - (28%)
Similarity:127/248 - (51%) Gaps:13/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PEHIRRLAQEQ-GECPSSKDKVIEQFRNYILEHNECQPH---RSDAKYLEKFLRARYWKIENSYK 85
            || ::::|:|| .|.|...:..::.|:.:|    |.|||   |.|.::|..|||...:.:|.:..
  Fly    10 PE-LQKVAKEQLKEDPERLEADLQAFKTWI----EQQPHLNPRMDDQFLVAFLRGCKYSLERAKS 69

  Fly    86 LLCSYYRFREQNKSFYEKVRPLD--LRHVGQSDILTVTPY-RDQHGHRILIYRFGLWRPNQVTVD 147
            .|..||..:.:...::......|  .|.:.|:..:...|. .:::|.||.|:|.||....:.|:.
  Fly    70 KLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWRMGLVPVEKYTML 134

  Fly   148 DIFRATIVLQELGSLE-PISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSAL 211
            :..:....:||:..|| ..:.:.|.|.|.|:|.....|:..::||:|:|.......::|:|..|.
  Fly   135 ECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQ 199

  Fly   212 HIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGG 264
            |.:|....|...|.:|||.::..|:.:|::||:.|..|.:.|..::||:.|||
  Fly   200 HFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 14/49 (29%)
SEC14 112..265 CDD:238099 46/155 (30%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 14/49 (29%)
SEC14 97..253 CDD:238099 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.