DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and Clvs2

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_780657.1 Gene:Clvs2 / 215890 MGIID:2443223 Length:327 Species:Mus musculus


Alignment Length:252 Identity:69/252 - (27%)
Similarity:129/252 - (51%) Gaps:2/252 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCS 89
            ||.:.:...|..|.|.:..:.|::.|:.::...:....|:|..::.:|||||.:....:::||..
Mouse    10 PETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQ 74

  Fly    90 YYRFREQNKSFYEKVRPLD--LRHVGQSDILTVTPYRDQHGHRILIYRFGLWRPNQVTVDDIFRA 152
            |:.:|:||...::..:..|  ::...:..........|.:|.:||:.....|..::.|:.||.||
Mouse    75 YFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRA 139

  Fly   153 TIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQN 217
            .::..|....:|..|:.|.|.|.|..:...:....|:|::.:..|..|..|.|.|...:|.|||.
Mouse   140 ILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPNMLRLAIEGLQDSFPARFGGIHFVNQP 204

  Fly   218 WVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGGLHEDYSYTLW 274
            |..:|.:.:.:|||....|:::::||:::.|||:.|:||.||..:||:...|....|
Mouse   205 WYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/46 (24%)
SEC14 112..265 CDD:238099 45/152 (30%)
Clvs2NP_780657.1 CRAL_TRIO_N 29..75 CDD:215024 11/45 (24%)
SEC14 106..251 CDD:238099 44/144 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.