DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and F20G2.3

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_506408.1 Gene:F20G2.3 / 179870 WormBaseID:WBGene00008987 Length:377 Species:Caenorhabditis elegans


Alignment Length:274 Identity:60/274 - (21%)
Similarity:105/274 - (38%) Gaps:54/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSKDKV-IEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQN---KSF 100
            |..|:| |.:.|..:.||  ..|:......|.::|:...:|::.....|.::..||:.:   .|.
 Worm     4 SESDRVAINELREAVKEH--LTPYYDTDFNLLRWLKGHDYKMDVIKPKLINHLLFRKSDWDLDSL 66

  Fly   101 YEKVRPLDLRH------VGQSDILTVTPYR-DQHGHRILIYRFGLW-RPNQVTVDDIFRATI--- 154
            .:|.|...:.|      .|:|.|:..|... :|.|..      ..| ..:....::|.||.:   
 Worm    67 ADKPRDHPVHHHWKTGLTGESGIIPNTIVNIEQTGSN------DYWGMLHSYPTNEILRARVHDL 125

  Fly   155 --VLQELGSLE-------PISQIVGGVGI-FDLKDL-----GLEHILHLSPSVAQKMIALLVTSM 204
              :|:.:..||       .:..|:...|| ||.:.:     ||..|   |..:|:..:.|:    
 Worm   126 ESMLKAVMDLEKKTNQQCSVIYIMDLTGIKFDKRTITLLTGGLSAI---SAFMAEHYVELV---- 183

  Fly   205 PIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSD-MTSLHKHINPEHLPKRYGGLHED 268
                .:..:||.....:|.:.|.||.|....|.|..|..|: ...:.|......||..:....:|
 Worm   184 ----HSFVLVNVPAFISAIWTIAKPLLPERTRNKCNILNSEWRVEVLKMAEGSCLPSYWNDEEDD 244

  Fly   269 YSYTLWLDMLKEQC 282
            ..:|..:    |:|
 Worm   245 GPFTAPI----EKC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/47 (23%)
SEC14 112..265 CDD:238099 38/173 (22%)
F20G2.3NP_506408.1 SEC14 72..243 CDD:214706 39/187 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.