DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and hpo-28

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_498232.3 Gene:hpo-28 / 175798 WormBaseID:WBGene00015148 Length:567 Species:Caenorhabditis elegans


Alignment Length:264 Identity:48/264 - (18%)
Similarity:102/264 - (38%) Gaps:72/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IEQFRNYILE-------HNECQPH--RSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFY 101
            :.:.|:.||:       |.....|  |.:..:|::||.:..:.::.:|.::....::|   ::| 
 Worm    27 VHELRSRILQDPAISVKHLSDDVHRIRHEDWWLDRFLGSVNYDVDIAYAIMLECLKWR---RNF- 87

  Fly   102 EKVRPLDLRHVGQSDILTVTPYRDQ-----HG------HRILI----YRFGLWRPNQVTVDDIFR 151
                     .|.:..:|::.|..|.     ||      |.:.|    |:.|         ||.|.
 Worm    88 ---------EVDRISLLSLKPLLDNQLMYLHGKDLQNRHMLWIMMNKYKNG---------DDGFE 134

  Fly   152 ATIVL------QELGSLEPISQIVG--GVGIFDLKDLGLEHILHLSPSVAQKMI-ALLVTSMPIR 207
            .....      .|....:|::..:.  |.|:.::....::.|:|.|.......| ::|:...|. 
 Worm   135 KLFTFWIERHYMEYKGCQPLTVFIDMTGTGLKNMSFDAMKFIIHSSKYYYPNSIESILIFENPA- 198

  Fly   208 TSALHIVNQNWVFNAAFKIFKPFLN---AAMREKLYIHGSDMTSLHKHINPEHLPKRYGGLHEDY 269
                       :.||::|:...:|.   |:.|..|....:.::..| ::...||.:..||. :.:
 Worm   199 -----------ILNASWKVIGSWLESSAASQRHDLLTFVTKLSVTH-YVPKSHLLEHQGGT-DTF 250

  Fly   270 SYTL 273
            .:|:
 Worm   251 KFTM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 10/52 (19%)
SEC14 112..265 CDD:238099 34/179 (19%)
hpo-28NP_498232.3 SEC14 105..247 CDD:238099 30/163 (18%)
Motile_Sperm <381..460 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.