DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and C34C12.6

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:246 Identity:47/246 - (19%)
Similarity:87/246 - (35%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DKVIEQFRNYILEHNECQPHRSDAKYLEKF-----------------LRARYWKIENSYKLLCSY 90
            :|:::.|..|:..........:|  :.|||                 |:.|.|..|::..|... 
 Worm    58 EKLVKNFATYLASRKAAGFVGND--FAEKFFELPSIAPFLQFIASSRLQDRQWSDEHNAFLFVE- 119

  Fly    91 YRFREQNKSFYEKVRPLD--LRHVGQSDILTVTPYRDQHGHRILIYRFGLWRPNQVTVDDIFRAT 153
             |...|.|.|.:..:..|  |...|.|::|           :.||.|    |..:.:.|.     
 Worm   120 -RAWSQPKEFIKTFKTSDYLLHCFGYSEML-----------QQLILR----REKKQSADK----- 163

  Fly   154 IVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSM-----PIRTSALHI 213
                     .|:..||    ||||..:.:..  :::|......:..:.:.:     |.....:::
 Worm   164 ---------GPVQFIV----IFDLNTVNITD--YVNPMSGYMKLWQIRSELWQDWFPEMVQRIYL 213

  Fly   214 VNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGG 264
            .|...:....:|:.:.||:....:::.|.........|.:.|..:||.|||
 Worm   214 TNPPRLLGLLWKVARVFLSEENLKRIEIISDKSDLAGKFLPPWLVPKEYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 12/63 (19%)
SEC14 112..265 CDD:238099 29/158 (18%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 40/211 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162244
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.