DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and ctg-2

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:277 Identity:61/277 - (22%)
Similarity:101/277 - (36%) Gaps:66/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKI--ENSYKLLCSYYR 92
            |::...||...|..|::::.|..|  |.|.:..:   :|.:.|...| |.|  :....::....:
 Worm    12 RMSTSTGEITESDRKLLDELRKRI--HKELELVK---EYDDDFSLMR-WLIGWDRKIDVVVPKIK 70

  Fly    93 FREQNKSFYEKVRPLDLRHVGQSDILTV-----------TPYRDQHGHRILIYRFGLWRPNQVTV 146
            |         .:|.:....:.|.|:.|:           .|.|...|..|     ||...|.|..
 Worm    71 F---------SLRAIHALGLDQEDLSTLEKVAQKCDDCSVPLRYLPGSLI-----GLDHENNVVS 121

  Fly   147 ------------------DDIFRATI-----VLQELGSLE-----PISQIVGGVGIFDLKDLGLE 183
                              .|::|..|     |:|.:..:|     |:...|    ||||..|.:.
 Worm   122 LQMIGHLDAAGLMPATRNSDLYRMRIAESEGVMQIIRKMEKEQGKPLGTSV----IFDLDGLSMV 182

  Fly   184 HILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTS 248
            .|...:..|...|::.|....|.....:.|||........:.:..|.|....::|:.|.|:|...
 Worm   183 QIDLAALKVVTTMLSQLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQKVKILGNDWKQ 247

  Fly   249 -LHKHINPEHLPKRYGG 264
             |.::|..|.|.:|:||
 Worm   248 HLKENIGEEVLFERWGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 10/48 (21%)
SEC14 112..265 CDD:238099 45/193 (23%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 42/176 (24%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.