DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and H41C03.1

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:291 Identity:59/291 - (20%)
Similarity:103/291 - (35%) Gaps:95/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LNITEEEVPEHIRRLAQEQGECPSSKDKVIEQF----------RNYILEHNECQPHRSDAKYLEK 71
            :|..|.|..:::|.      ||   ||.:.|.:          :.|..:.:|....      |.:
 Worm     1 MNQKEREFVDYLRH------EC---KDLLTEYYDTDFNLLRWAQGYGFDKDEALAE------LRR 50

  Fly    72 FLRAR-YWKIEN------SYKLLCSYYRFREQNKSFYEKVRPLDL-------------RHVGQSD 116
            .||.| |:.::|      .:.:|..|:              ||.|             ...|:.|
 Worm    51 HLRFRQYYDLDNILTNVPDHPILKKYF--------------PLGLVGETGKDNQLLVIECAGRID 101

  Fly   117 ILTVTPYRDQHGHRILIYRFGLWRPNQVTVDDIFR------ATIVLQELGSL--EP--ISQIVGG 171
            ::.:  .:..|....||.||.........::::.|      :.|.:.:|..|  :|  ||.:.|.
 Worm   102 LMGI--LKSVHLSDFLIQRFKFQEKMLAAMNEMERKYGTQCSVIYILDLEGLKFDPALISIVTGP 164

  Fly   172 VGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMR 236
            ..|                     :.|.:.|:.|...:.|.::|........:|...|.|....|
 Worm   165 YRI---------------------LWASVYTAYPEWINTLFLINAPSFMTLLWKAIGPLLPERTR 208

  Fly   237 EKLYI--HGSD-MTSLHKHINPEHLPKRYGG 264
            .|:.|  ..|| .||:.||.:.:::||.:||
 Worm   209 NKVRICSGNSDWKTSVQKHAHIDNIPKHWGG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/63 (17%)
SEC14 112..265 CDD:238099 37/166 (22%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 42/208 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.