DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10026 and Sec14l4

DIOPT Version :9

Sequence 1:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:259 Identity:63/259 - (24%)
Similarity:107/259 - (41%) Gaps:43/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQNKSF 100
            |:....:.:.:.:||..:.:.....| ::|..:|.::||||.:.::.|..:|..:..||.|..  
Mouse     6 GDLSPQQQEALARFRETLQDLLPTLP-KADDYFLLRWLRARNFDLKKSEDMLRKHVEFRNQQN-- 67

  Fly   101 YEKVRPLDLRHVGQSDILT--------------VTPYRDQHGHRILIYRFGLWRPN----QVTVD 147
                  ||       .|||              ::.| |..|..:.....|...|.    ..:..
Mouse    68 ------LD-------QILTWQAPEVIQLYDSGGLSGY-DYEGCPVWFDIIGTMDPKGLFMSASKQ 118

  Fly   148 DIFRATIVLQE--LGSLEPISQIVGG-----VGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMP 205
            |:.|..|.:.|  |...|..||.:|.     |.:||::.|.|.|:...:..|.|:..|:|..:.|
Mouse   119 DMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGLSLRHLWKPAVEVYQQFFAILEANYP 183

  Fly   206 IRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSD-MTSLHKHINPEHLPKRYGGLHED 268
            .....|.|:....:|..||.:.|.|:....::|:.|.|.: ...|.|.::|:.||..:||...|
Mouse   184 ETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPVEFGGTMTD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/46 (24%)
SEC14 112..265 CDD:238099 44/178 (25%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 11/46 (24%)
SEC14 77..244 CDD:214706 41/167 (25%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.