DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanGAP and RANGAP2

DIOPT Version :9

Sequence 1:NP_001260578.1 Gene:RanGAP / 35223 FlyBaseID:FBgn0003346 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001318597.1 Gene:RANGAP2 / 832052 AraportID:AT5G19320 Length:545 Species:Arabidopsis thaliana


Alignment Length:430 Identity:110/430 - (25%)
Similarity:166/430 - (38%) Gaps:92/430 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AADVQDVVDAL----NKQTTVHYLNLDGNTLGVEAAKAIGEGLKRHPEFRKALWKNMFTGRLISE 91
            |.:.::::..|    |..|.:.:.|..........|:.|...||  .:.::....:...||...|
plant   137 AEEAEELLKPLKEPGNAYTKICFSNRSFGLGAARVAEPILASLK--DQLKEVDLSDFVAGRPELE 199

  Fly    92 IPEALKHLGAALIVAGAKLTVLDLSDNALGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGS 156
            ..|.:.....||  .|:.|:.|:|||||||..|:|....||:|  ..||:||.|.|.|:..|...
plant   200 ALEVMNIFSDAL--QGSILSSLNLSDNALGEKGVRAFGALLKS--LSSLEELYLMNDGISKEAAQ 260

  Fly   157 MLSRALID------LHANANKAG-------------FPLQLRVFIGSRNRLEDAGATEMATAFQT 202
            .:|..:..      ||.:.|..|             .|| |..|..|..|:...|...::.|.:.
plant   261 AVSELIPSTENLRVLHFHNNMTGDEGALAIAEVVKRSPL-LENFRCSSTRVGSKGGIALSEALEH 324

  Fly   203 LKTFEEIVLEQNSIYIEGVEALAE---SFKHNPHL--------------------------RVLN 238
            ....|::.|..|....|...:|::   ||||...|                          .||.
plant   325 CTHMEKLDLRDNMFGTEAGVSLSKTLSSFKHMTELYLSYLNLEDEGAIAIVNALKESASPIEVLE 389

  Fly   239 MNDNTLKSEGAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLEVIDLGFNEINS 303
            |..|.:..|.|..||..:.....|.:::..:..:|..|.......:|.|:.:|:.||:..|.|..
plant   390 MAGNDITVEAASAIAACVAAKQDLNKLNLSENELKDEGCVQIANCIEEGHSKLQYIDMSTNYIRR 454

  Fly   304 DGGLVLVNAMGNKPKLRILNLDGNSFGEEGSEKIISEMSKLP-TAAALQPFQHQEEEDLEDEYQA 367
            .|...|.:.:..|...::||:|||...|||.|::.....|.| ...||                 
plant   455 AGARALAHVVVKKEAFKLLNIDGNIISEEGIEELKEIFKKSPELLGAL----------------- 502

  Fly   368 DKQDADYEEEEEVHEHANDTTEEADEDSEGDEDDEEDEGD 407
            |:.|.|.||               |:|.|.||:|||:||:
plant   503 DENDPDGEE---------------DDDDEEDEEDEENEGN 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanGAPNP_001260578.1 leucine-rich repeat 45..77 CDD:275380 6/31 (19%)
LRR_RI 50..337 CDD:238064 87/334 (26%)
leucine-rich repeat 78..109 CDD:275380 7/30 (23%)
leucine-rich repeat 110..139 CDD:275380 14/28 (50%)
leucine-rich repeat 140..167 CDD:275380 9/32 (28%)
leucine-rich repeat 178..205 CDD:275380 6/26 (23%)
leucine-rich repeat 206..233 CDD:275380 9/29 (31%)
leucine-rich repeat 234..261 CDD:275380 9/52 (17%)
leucine-rich repeat 262..290 CDD:275380 5/27 (19%)
RANGAP2NP_001318597.1 WPP 13..109 CDD:404775
LRR_RI 183..450 CDD:423007 68/271 (25%)
leucine-rich repeat 216..243 CDD:275380 14/28 (50%)
leucine-rich repeat 244..271 CDD:275380 8/26 (31%)
leucine-rich repeat 272..295 CDD:275380 4/22 (18%)
leucine-rich repeat 300..327 CDD:275380 6/26 (23%)
leucine-rich repeat 328..355 CDD:275380 7/26 (27%)
leucine-rich repeat 356..379 CDD:275380 1/22 (5%)
leucine-rich repeat 385..408 CDD:275380 8/22 (36%)
leucine-rich repeat 413..441 CDD:275380 5/27 (19%)
leucine-rich repeat 442..462 CDD:275380 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5238
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2094
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1357476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3162
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2301
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.