DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanGAP and RANGAP1

DIOPT Version :9

Sequence 1:NP_001260578.1 Gene:RanGAP / 35223 FlyBaseID:FBgn0003346 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001190166.1 Gene:RANGAP1 / 825488 AraportID:AT3G63130 Length:535 Species:Arabidopsis thaliana


Alignment Length:408 Identity:111/408 - (27%)
Similarity:177/408 - (43%) Gaps:62/408 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VQDVVDALNKQTTVHYLNLDGNTLGVEAAKAIGEGLKR-HPEFRKALWKNMFTGRLISEIPEALK 97
            ::.:.|..|..|.:.:.|   .:.|.||||.....|.. ..:..:....:...||..:|..|.:.
plant   139 LRPLADPRNSYTKIRFSN---RSFGSEAAKFAASVLSSIKDQLTEVDLSDFVAGRPEAEALEVMN 200

  Fly    98 HLGAALIVAGAKLTVLDLSDNALGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGSMLSRAL 162
            ...:||  .|:||..|:|||||||..|:|....|:.|.  :.|:||.|.|.|:..:.    :||:
plant   201 MFSSAL--EGSKLRYLNLSDNALGEKGIRAFASLINSQ--HDLEELYLMNDGISEDA----ARAV 257

  Fly   163 IDLHANANKAGFPLQLRVFIGSRNRLEDAGATEMATAFQTLKTFEEIVLEQNSIYIEGVEALAES 227
            .:|..:.:|      :||.....|...|.|||.:|...:...:.|:.......|..||..||||:
plant   258 RELLPSTDK------IRVLQFHNNMTGDEGATAIAEIVRECPSLEDFRCSSTRIGSEGGVALAEA 316

  Fly   228 FKHNPHLRVLNMNDNTLKSEGAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLE 292
            .:|..||:.|::.||....||...:|:.|..|..|.|:......::..|.....|||.:....||
plant   317 LEHCSHLKKLDLRDNMFGVEGGIALAKTLSVLTHLTEIYMSYLNLEDEGTEALSEALLKSAPSLE 381

  Fly   293 VIDLGFNEI--NSDGGLVLVNAMGNKPKLRILNLDGNSFGEEGSEKIISEMSKLPTAAALQPFQH 355
            |::|..|:|  .|.|.|..  .:.:|..|..|||..|...:||:..|         |.|::....
plant   382 VLELAGNDITVKSTGNLAA--CIASKQSLAKLNLSENELKDEGTILI---------AKAVEGHDQ 435

  Fly   356 QEEEDL-------------------EDEYQADKQDADYEEEEEVHEHANDTTEEA--------DE 393
            ..|.||                   ::.::....:.::..||.:.| .||..::.        |.
plant   436 LVEVDLSTNMIRRAGARALAQTVVKKNTFKLLNINGNFISEEGIDE-VNDMFKDCLDKLVPLDDN 499

  Fly   394 DSEG---DEDDEEDEGDE 408
            |.||   :::|||:||::
plant   500 DPEGEDFEDEDEEEEGED 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanGAPNP_001260578.1 leucine-rich repeat 45..77 CDD:275380 8/32 (25%)
LRR_RI 50..337 CDD:238064 88/289 (30%)
leucine-rich repeat 78..109 CDD:275380 7/30 (23%)
leucine-rich repeat 110..139 CDD:275380 13/28 (46%)
leucine-rich repeat 140..167 CDD:275380 9/26 (35%)
leucine-rich repeat 178..205 CDD:275380 8/26 (31%)
leucine-rich repeat 206..233 CDD:275380 9/26 (35%)
leucine-rich repeat 234..261 CDD:275380 9/26 (35%)
leucine-rich repeat 262..290 CDD:275380 6/27 (22%)
RANGAP1NP_001190166.1 WPP 14..110 CDD:404775
LRR_RI 133..446 CDD:423007 97/334 (29%)
leucine-rich repeat 211..234 CDD:275380 12/22 (55%)
leucine-rich repeat 239..259 CDD:275380 8/23 (35%)
leucine-rich repeat 260..294 CDD:275380 10/39 (26%)
leucine-rich repeat 295..322 CDD:275380 9/26 (35%)
leucine-rich repeat 323..350 CDD:275380 9/26 (35%)
leucine-rich repeat 351..379 CDD:275380 6/27 (22%)
leucine-rich repeat 380..407 CDD:275380 10/28 (36%)
leucine-rich repeat 408..435 CDD:275380 10/35 (29%)
leucine-rich repeat 436..455 CDD:275380 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5238
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2094
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1357476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3162
orthoMCL 1 0.900 - - OOG6_103239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2301
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.