DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanGAP and AT3G06000

DIOPT Version :9

Sequence 1:NP_001260578.1 Gene:RanGAP / 35223 FlyBaseID:FBgn0003346 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_187251.1 Gene:AT3G06000 / 819771 AraportID:AT3G06000 Length:211 Species:Arabidopsis thaliana


Alignment Length:197 Identity:47/197 - (23%)
Similarity:81/197 - (41%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 SRNRLEDAGATEMATAFQ-TLKTFEEIVLEQNSIYIEGVEALAESFKHNPHLRVLNMNDNTLKSE 247
            |...||:.||..:..|.: :..:.:.|.:..|:|..|...|:|.......||:.||:::|.||.|
plant    45 SYTNLENGGAIALVNALKNSAPSLQVIEMAGNNITYEAATAIAVCLAAKRHLKKLNLSENDLKDE 109

  Fly   248 GAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLEVIDLGFNEINSDGGLVLVNA 312
            |..:|.:::.                              :..||.:|:.:|::..:|.|.|...
plant   110 GCVEIVKSME------------------------------DWELEYVDMSYNDLRREGALRLARV 144

  Fly   313 MGNKPKLRILNLDGNSFGEEGSEKIISEMSKLPTAAALQPFQHQEEEDLEDEYQADKQDADYEEE 377
            :..|...::||:|||....:|.|:|....:..|  ..|.|..       ::.|..|..| |..|.
plant   145 VVKKGSFKMLNIDGNMISLKGIEEIKVIFTNCP--KLLGPLD-------KNVYNVDDDD-DLREN 199

  Fly   378 EE 379
            :|
plant   200 DE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanGAPNP_001260578.1 leucine-rich repeat 45..77 CDD:275380
LRR_RI 50..337 CDD:238064 37/153 (24%)
leucine-rich repeat 78..109 CDD:275380
leucine-rich repeat 110..139 CDD:275380
leucine-rich repeat 140..167 CDD:275380
leucine-rich repeat 178..205 CDD:275380 6/21 (29%)
leucine-rich repeat 206..233 CDD:275380 6/26 (23%)
leucine-rich repeat 234..261 CDD:275380 9/26 (35%)
leucine-rich repeat 262..290 CDD:275380 0/27 (0%)
AT3G06000NP_187251.1 LRR_RI <33..>170 CDD:423007 37/154 (24%)
leucine-rich repeat 39..67 CDD:275380 6/21 (29%)
leucine-rich repeat 68..95 CDD:275380 6/26 (23%)
leucine-rich repeat 96..122 CDD:275380 9/55 (16%)
leucine-rich repeat 123..143 CDD:275380 7/19 (37%)
leucine-rich repeat 144..178 CDD:275380 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5238
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1357476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3162
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.