Sequence 1: | NP_001260578.1 | Gene: | RanGAP / 35223 | FlyBaseID: | FBgn0003346 | Length: | 596 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_187251.1 | Gene: | AT3G06000 / 819771 | AraportID: | AT3G06000 | Length: | 211 | Species: | Arabidopsis thaliana |
Alignment Length: | 197 | Identity: | 47/197 - (23%) |
---|---|---|---|
Similarity: | 81/197 - (41%) | Gaps: | 41/197 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 184 SRNRLEDAGATEMATAFQ-TLKTFEEIVLEQNSIYIEGVEALAESFKHNPHLRVLNMNDNTLKSE 247
Fly 248 GAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLEVIDLGFNEINSDGGLVLVNA 312
Fly 313 MGNKPKLRILNLDGNSFGEEGSEKIISEMSKLPTAAALQPFQHQEEEDLEDEYQADKQDADYEEE 377
Fly 378 EE 379 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RanGAP | NP_001260578.1 | leucine-rich repeat | 45..77 | CDD:275380 | |
LRR_RI | 50..337 | CDD:238064 | 37/153 (24%) | ||
leucine-rich repeat | 78..109 | CDD:275380 | |||
leucine-rich repeat | 110..139 | CDD:275380 | |||
leucine-rich repeat | 140..167 | CDD:275380 | |||
leucine-rich repeat | 178..205 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 206..233 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 234..261 | CDD:275380 | 9/26 (35%) | ||
leucine-rich repeat | 262..290 | CDD:275380 | 0/27 (0%) | ||
AT3G06000 | NP_187251.1 | LRR_RI | <33..>170 | CDD:423007 | 37/154 (24%) |
leucine-rich repeat | 39..67 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 68..95 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 96..122 | CDD:275380 | 9/55 (16%) | ||
leucine-rich repeat | 123..143 | CDD:275380 | 7/19 (37%) | ||
leucine-rich repeat | 144..178 | CDD:275380 | 10/35 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5238 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1357476at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm3162 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |