DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanGAP and LOC733866

DIOPT Version :9

Sequence 1:NP_001260578.1 Gene:RanGAP / 35223 FlyBaseID:FBgn0003346 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001039071.1 Gene:LOC733866 / 733866 -ID:- Length:404 Species:Xenopus tropicalis


Alignment Length:335 Identity:69/335 - (20%)
Similarity:128/335 - (38%) Gaps:88/335 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LNLDGNTLGVEAAKAIGEGLKRHPEFRKALWKNMFTGRLISEIPEALKHLGAALIVAGAKLTVLD 114
            :||..:   ::..:...:..|...:..|.:.||:...:..:::        ||.|.|.:.||...
 Frog   105 INLHND---MDVVRFFPDTFKELRDLEKLVLKNVNLSKDSAKL--------AAFIAAFSNLTCFH 158

  Fly   115 LS-DNALGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGSMLSRALIDLHANANKAGFPLQL 178
            |. |:.  |..|:..|.|.|:.   ::||:.|        .|..|..:|: :|. |:.....|.|
 Frog   159 LECDHC--PEFMKVFEGLSRNE---NIQEINL--------RGRFLHDSLM-VHL-ASLLPLFLNL 208

  Fly   179 RVFIGSRNRLED------AGATEMATAFQTLKTFEEIVLEQNSIYIEG-------VEALAESFKH 230
            :||     .::|      ..|.....|...|...||       ||:.|       .:.:.:.|::
 Frog   209 KVF-----NIKDMYFQNMEKANTFVVALPNLARLEE-------IYLPGGCGIRMIPQTIIQQFQY 261

  Fly   231 NPHLRVLNMNDNTLKSEGAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLEVID 295
            ..:||:::...|.| ::|                     ||::...|...|..     ..:|.:|
 Frog   262 LRNLRIISFPSNVL-NDG---------------------CLLQLAHAVRDGHL-----SNIEKLD 299

  Fly   296 LGFN-EINSDGGLVLVNAMGNKPKLRILNLDGNSFGEEGSE------KIISEMSKLPTAAALQPF 353
            |..| :|...|.......:.|.|||..|:: ..::|.|...      .::..:::||:...|..:
 Frog   300 LTANHDITQSGWRDFFQLVDNLPKLNSLSI-SRAYGREIKADPLTFIALVQCVARLPSLRNLYMY 363

  Fly   354 QH-QEEEDLE 362
            .. .:|:|:|
 Frog   364 SWLLDEKDIE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanGAPNP_001260578.1 leucine-rich repeat 45..77 CDD:275380 3/26 (12%)
LRR_RI 50..337 CDD:238064 63/307 (21%)
leucine-rich repeat 78..109 CDD:275380 6/30 (20%)
leucine-rich repeat 110..139 CDD:275380 9/29 (31%)
leucine-rich repeat 140..167 CDD:275380 6/26 (23%)
leucine-rich repeat 178..205 CDD:275380 7/32 (22%)
leucine-rich repeat 206..233 CDD:275380 6/33 (18%)
leucine-rich repeat 234..261 CDD:275380 5/26 (19%)
leucine-rich repeat 262..290 CDD:275380 4/27 (15%)
LOC733866NP_001039071.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1357476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.