DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanGAP and LOC100333051

DIOPT Version :9

Sequence 1:NP_001260578.1 Gene:RanGAP / 35223 FlyBaseID:FBgn0003346 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_021326497.1 Gene:LOC100333051 / 100333051 -ID:- Length:685 Species:Danio rerio


Alignment Length:407 Identity:102/407 - (25%)
Similarity:161/407 - (39%) Gaps:100/407 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QLGQEQGISFENKVLSWNTAADVQDVVDALNKQTTVHYLNLDGNTLGVEAAKA-IGEGLKRHPEF 75
            |...|:.::.|:.:|.....|..|     |.|...:.| ..|....|::.|:| :..||... .|
Zfish   311 QKDYEEKLTDEDMILKLGKVAFQQ-----LMKGNIIFY-EEDLRECGIDVAEASVYSGLCTQ-IF 368

  Fly    76 RKALWKNMFTGRLISEIPEALKHLGAALIVAGAKLTVLD-----------------LSD----NA 119
            |:..  .::.|::.|.:..:::...|||.|   .|:.::                 :.|    |:
Zfish   369 REEF--GLYQGKVFSFVHLSIQEHLAALYV---HLSCINNNRDEFEEINKQSLWSKVKDHFHFNS 428

  Fly   120 LGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGSMLSRALIDLHANANKAGFPLQLRVFIGS 184
            |.|..:..|..||  .:.|.|..  |.:|||.....:.|:.||     .:|    |..|||...|
Zfish   429 LKPVSLFSLHHLL--SIIYCLHR--LSDCGLTEMDCAALASAL-----RSN----PSDLRVLNLS 480

  Fly   185 RNRLEDAGATEMATAFQTLKTFEEIVLEQNSIYIEGVEALAESFKHNP-HLRVLNMNDNTLKSEG 248
            ||.|.|:.:...|.........|::.|....:..||..|||.:.|.|| |||.||:::|      
Zfish   481 RNILVDSVSLLSAVLEDPCSKLEKLWLRYCDLTDEGCAALASALKSNPEHLRDLNLSEN------ 539

  Fly   249 AEKIAEALPFLPLLREMSFGDCLIKTNGAYHFG----------EALERGNERLEVIDLGFNEIN- 302
              |:.:::..|..:.|..  .|.:||...|:.|          .||....|.|..:||..|::. 
Zfish   540 --KLGDSVTLLSAVLEDP--HCKLKTLWLYNCGLTDEGCAALALALRSNPEHLRDLDLSVNKLRD 600

  Fly   303 ----------------------SDGGL------VLVNAMGNKPK-LRILNLDGNSFGEEGSEKII 338
                                  ||.||      .|.:|:.:.|: |..|||..|..| |...|::
Zfish   601 SGIKLLSPLLEDPHCKLEKLWLSDCGLTDEGCAALASALRSNPEHLTELNLSKNKLG-ESDVKLL 664

  Fly   339 SEMSKLPTAAALQPFQH 355
            |:: |..|...|:.|.:
Zfish   665 SDL-KDDTHYKLKKFNY 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanGAPNP_001260578.1 leucine-rich repeat 45..77 CDD:275380 8/32 (25%)
LRR_RI 50..337 CDD:238064 87/349 (25%)
leucine-rich repeat 78..109 CDD:275380 6/30 (20%)
leucine-rich repeat 110..139 CDD:275380 8/49 (16%)
leucine-rich repeat 140..167 CDD:275380 8/26 (31%)
leucine-rich repeat 178..205 CDD:275380 9/26 (35%)
leucine-rich repeat 206..233 CDD:275380 10/27 (37%)
leucine-rich repeat 234..261 CDD:275380 7/26 (27%)
leucine-rich repeat 262..290 CDD:275380 8/37 (22%)
LOC100333051XP_021326497.1 FISNA 1..67 CDD:316956
NACHT 78..245 CDD:310381
LRR_RI 423..667 CDD:330982 73/267 (27%)
leucine-rich repeat 474..501 CDD:275380 9/26 (35%)
leucine-rich repeat 502..526 CDD:275380 7/23 (30%)
leucine-rich repeat 531..558 CDD:275380 8/36 (22%)
leucine-rich repeat 559..587 CDD:275380 6/27 (22%)
leucine-rich repeat 588..616 CDD:275380 4/27 (15%)
leucine-rich repeat 617..645 CDD:275380 7/27 (26%)
leucine-rich repeat 646..667 CDD:275380 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1357476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.