| Sequence 1: | NP_001260578.1 | Gene: | RanGAP / 35223 | FlyBaseID: | FBgn0003346 | Length: | 596 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021326503.1 | Gene: | LOC100329836 / 100329836 | -ID: | - | Length: | 289 | Species: | Danio rerio |
| Alignment Length: | 289 | Identity: | 73/289 - (25%) |
|---|---|---|---|
| Similarity: | 119/289 - (41%) | Gaps: | 63/289 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 100 GAALIVAGAK-----LTVLDLSDNALGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGSMLS 159
Fly 160 RALIDLHANANKAGFPLQLRVFIGSRNRLEDAGATEMATAFQTLKTFEEIVLEQNSIYIEGVEAL 224
Fly 225 AESFKHNP-HLRVLNMNDNTLKSEGAEKIAEALPFLPLLRE--------MSFGDCLIKTNGAYHF 280
Fly 281 GEALERGNERLEVIDLGFNE----------------------------INSDGGLVLVNAMGNKP 317
Fly 318 K-LRILNLDGNSFGEEGSEKIISEMSKLP 345 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RanGAP | NP_001260578.1 | leucine-rich repeat | 45..77 | CDD:275380 | |
| LRR_RI | 50..337 | CDD:238064 | 71/279 (25%) | ||
| leucine-rich repeat | 78..109 | CDD:275380 | 3/8 (38%) | ||
| leucine-rich repeat | 110..139 | CDD:275380 | 11/28 (39%) | ||
| leucine-rich repeat | 140..167 | CDD:275380 | 11/26 (42%) | ||
| leucine-rich repeat | 178..205 | CDD:275380 | 8/26 (31%) | ||
| leucine-rich repeat | 206..233 | CDD:275380 | 9/27 (33%) | ||
| leucine-rich repeat | 234..261 | CDD:275380 | 7/26 (27%) | ||
| leucine-rich repeat | 262..290 | CDD:275380 | 5/35 (14%) | ||
| LOC100329836 | XP_021326503.1 | LRR_RI | 3..287 | CDD:330982 | 73/289 (25%) |
| leucine-rich repeat | 27..54 | CDD:275380 | 11/28 (39%) | ||
| leucine-rich repeat | 55..83 | CDD:275380 | 13/36 (36%) | ||
| leucine-rich repeat | 84..111 | CDD:275380 | 8/26 (31%) | ||
| leucine-rich repeat | 112..135 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 141..168 | CDD:275380 | 8/34 (24%) | ||
| leucine-rich repeat | 169..197 | CDD:275380 | 4/27 (15%) | ||
| leucine-rich repeat | 198..225 | CDD:275380 | 3/26 (12%) | ||
| leucine-rich repeat | 226..254 | CDD:275380 | 4/27 (15%) | ||
| leucine-rich repeat | 255..276 | CDD:275380 | 7/21 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1357476at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||