DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and YPT7

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_013713.1 Gene:YPT7 / 855012 SGDID:S000004460 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:77/191 - (40%)
Similarity:119/191 - (62%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERY-TLQIWDTAGQ 71
            :|..:|||:||||.||||::|:.|:|.::|.:....|||.:|:.|::.|||::. |:|:||||||
Yeast     4 RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQ 68

  Fly    72 ERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQ-DKFPFIVVGNKNDIPAQ 135
            |||::|...||||:|.|:|.|.:.:..|.:.:..||:|||.:|:|:. :.|||:::|||.|....
Yeast    69 ERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEES 133

  Fly   136 KRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQH-GDT 195
            |:.||..:.|:............||:|.|.||..||          |.:|.:.|:|: .||
Yeast   134 KKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAF----------EEIARSALQQNQADT 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 71/171 (42%)
Ras 14..177 CDD:278499 69/164 (42%)
YPT7NP_013713.1 Rab7 9..182 CDD:206655 74/182 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S534
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.