DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and RABG3A

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001154217.1 Gene:RABG3A / 826558 AraportID:AT4G09720 Length:217 Species:Arabidopsis thaliana


Alignment Length:178 Identity:71/178 - (39%)
Similarity:99/178 - (55%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQE 72
            ::..||||::|||.||||::|:.::|..::......|||.:|:.|::.:..:..|||||||||||
plant     4 RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQIWDTAGQE 68

  Fly    73 RFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYA------------DVDQDKFPFIV 125
            ||::|...||||:|.|.|.|.::...|...|..|..|||..|            ..|...|||||
plant    69 RFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQAWNIGMWTIAEASPSDPKTFPFIV 133

  Fly   126 VGNKNDIP-AQKRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFV 172
            :|||.|:. ...|.||......|||......:.|||:|...||.:||:
plant   134 LGNKIDVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEAFL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 71/178 (40%)
Ras 14..177 CDD:278499 69/172 (40%)
RABG3ANP_001154217.1 Rab7 9..193 CDD:206655 70/173 (40%)
RAB 9..190 CDD:197555 70/173 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.