DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and RAB7B

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_188512.1 Gene:RAB7B / 821415 AraportID:AT3G18820 Length:206 Species:Arabidopsis thaliana


Alignment Length:202 Identity:80/202 - (39%)
Similarity:118/202 - (58%) Gaps:19/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PPQKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAG 70
            |.::..||||:||||.||||::|:.::|..::......|||.:|:.|::..:...:|||||||||
plant     2 PSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAG 66

  Fly    71 QERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYAD-VDQDKFPFIVVGNKNDI-P 133
            ||||::|...||||:|.|:|.|.::...|.:.|..||.|||..|. .|.:.|||:::|||.|: .
plant    67 QERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPFVLIGNKVDVDD 131

  Fly   134 AQKRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQH------ 192
            ...|.||....:.|||.:....:.|||:|..|||.:||          :|:|:..|:..      
plant   132 GNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAF----------QCIAKDALKSGEEEELY 186

  Fly   193 -GDTIDL 198
             .||||:
plant   187 LPDTIDV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 72/171 (42%)
Ras 14..177 CDD:278499 70/164 (43%)
RAB7BNP_188512.1 Rab7 9..182 CDD:206655 74/182 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.