DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and RAB7A

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_565521.1 Gene:RAB7A / 816724 AraportID:AT2G21880 Length:212 Species:Arabidopsis thaliana


Alignment Length:163 Identity:68/163 - (41%)
Similarity:108/163 - (66%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRA 76
            ||||::|||.||||::|:.::|..::.:....|||.:|:.|::.:|.:..|||||||||||||::
plant     9 LLKVIVLGDSGVGKTSLMNQYVYKKFNKQYKATIGADFVTKELHIDEKSVTLQIWDTAGQERFQS 73

  Fly    77 LRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYAD-VDQDKFPFIVVGNKNDIP-AQKRQV 139
            |...||||:|.|:|.|.:::..|.:.|..|..|||..|: ::.:.|||:::|||.|:. ...|.|
plant    74 LGAAFYRGADCCVLVYDVNNLKSFETLNNWHTEFLKQANPMEPETFPFVLIGNKTDVDGGNSRVV 138

  Fly   140 SSDAVQQWCAEQKVACHIETSSKAATNVTDAFV 172
            |:....:||..:....:.|||:|..||:.:||:
plant   139 SNKRAIEWCGSKGNIPYHETSAKEDTNIDEAFL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 68/163 (42%)
Ras 14..177 CDD:278499 66/161 (41%)
RAB7ANP_565521.1 Rab7 10..181 CDD:206655 67/162 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.