DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and RAB7A

DIOPT Version :10

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_565521.1 Gene:RAB7A / 816724 AraportID:AT2G21880 Length:212 Species:Arabidopsis thaliana


Alignment Length:163 Identity:68/163 - (41%)
Similarity:108/163 - (66%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRA 76
            ||||::|||.||||::|:.::|..::.:....|||.:|:.|::.:|.:..|||||||||||||::
plant     9 LLKVIVLGDSGVGKTSLMNQYVYKKFNKQYKATIGADFVTKELHIDEKSVTLQIWDTAGQERFQS 73

  Fly    77 LRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYAD-VDQDKFPFIVVGNKNDIP-AQKRQV 139
            |...||||:|.|:|.|.:::..|.:.|..|..|||..|: ::.:.|||:::|||.|:. ...|.|
plant    74 LGAAFYRGADCCVLVYDVNNLKSFETLNNWHTEFLKQANPMEPETFPFVLIGNKTDVDGGNSRVV 138

  Fly   140 SSDAVQQWCAEQKVACHIETSSKAATNVTDAFV 172
            |:....:||..:....:.|||:|..||:.:||:
plant   139 SNKRAIEWCGSKGNIPYHETSAKEDTNIDEAFL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 68/163 (42%)
RAB7ANP_565521.1 Rab7 10..181 CDD:206655 67/162 (41%)

Return to query results.
Submit another query.