DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and rab9b

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001072679.1 Gene:rab9b / 780136 XenbaseID:XB-GENE-491211 Length:201 Species:Xenopus tropicalis


Alignment Length:194 Identity:103/194 - (53%)
Similarity:137/194 - (70%) Gaps:11/194 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQER 73
            ||.||||::|||||||||:|:.|:|.|:::...||||||||:|:|:.|||...||||||||||||
 Frog     4 KSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRLVTLQIWDTAGQER 68

  Fly    74 FRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDIPAQKR 137
            |::||||||||:|.|||.:::|||.|.:.|..||.||:.|||| :.|:|||:|:|||.|  ..:|
 Frog    69 FKSLRTPFYRGADCCLLTFSVDDRQSFENLSSWRKEFILYADVKEPDRFPFVVLGNKVD--KSER 131

  Fly   138 QVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQH---GDTIDL 198
            ::|:...:.||.|.....::|||:|..|||..||...:||     .:|..|..:|   |.||||
 Frog   132 EISTVDAETWCNENGGYPYLETSAKDDTNVDGAFEEAVRQ-----ALAVEEQVEHSVLGRTIDL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 94/169 (56%)
Ras 14..177 CDD:278499 89/163 (55%)
rab9bNP_001072679.1 P-loop_NTPase 3..171 CDD:393306 93/168 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3136
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0004055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5468
SonicParanoid 1 1.000 - - X2801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.