DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and rab9a

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001229903.1 Gene:rab9a / 751756 ZFINID:ZDB-GENE-060825-293 Length:201 Species:Danio rerio


Alignment Length:207 Identity:108/207 - (52%)
Similarity:143/207 - (69%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQER 73
            ||.||||::|||||||||:|:.|:|.|:::.:.||||||||:|||:.|||...||||||||||||
Zfish     4 KSSLLKVILLGDGGVGKSSLMNRYVTNKFDAHLFHTIGVEFLNKDLEVDGRTVTLQIWDTAGQER 68

  Fly    74 FRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDIPAQKR 137
            ||:||||||||||.|||.:::||..|...|..|:.||:.|||| :.:.|||:|:|||.|:  .:|
Zfish    69 FRSLRTPFYRGSDCCLLTFSVDDSQSFHNLVNWKKEFIYYADVKEPESFPFVVLGNKLDV--SER 131

  Fly   138 QVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQH---GDTIDLT 199
            ||||:..|:||.|.....:.|||:|.||||..||...:|:...:|     :..:|   .||::|.
Zfish   132 QVSSEEAQEWCMESGGYPYFETSAKDATNVAVAFEEAVRRVLSLE-----DRHEHLIPTDTVNLH 191

  Fly   200 RPIRLVQRRICC 211
            |..|...:  ||
Zfish   192 RKPRSATQ--CC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 99/169 (59%)
Ras 14..177 CDD:278499 94/163 (58%)
rab9aNP_001229903.1 Rab9 4..172 CDD:206697 99/169 (59%)
RAB 8..175 CDD:197555 96/168 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 196 1.000 Domainoid score I3080
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3702
OMA 1 1.010 - - QHG52476
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0004055
OrthoInspector 1 1.000 - - oto40517
orthoMCL 1 0.900 - - OOG6_105995
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5468
SonicParanoid 1 1.000 - - X2801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.