DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and RAB9B

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_057454.1 Gene:RAB9B / 51209 HGNCID:14090 Length:201 Species:Homo sapiens


Alignment Length:194 Identity:106/194 - (54%)
Similarity:139/194 - (71%) Gaps:11/194 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQER 73
            ||.||||::|||||||||:|:.|:|.|:::...||||||||:|:|:.|||...||||||||||||
Human     4 KSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQER 68

  Fly    74 FRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDIPAQKR 137
            |::||||||||:|.|||.:::|||.|.:.||.|:.||:.|||| |.:.|||:|:|||.|  .:.|
Human    69 FKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVD--KEDR 131

  Fly   138 QVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQH---GDTIDL 198
            ||:::..|.||.|.....::|||:|..||||.||...:||     .:|..|..:|   |.||||
Human   132 QVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQ-----VLAVEEQLEHCMLGHTIDL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 97/169 (57%)
Ras 14..177 CDD:278499 92/163 (56%)
RAB9BNP_057454.1 Rab9 3..172 CDD:206697 98/174 (56%)
Effector region. /evidence=ECO:0000250 36..44 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3136
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52476
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105995
Panther 1 1.100 - - LDO PTHR47981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5468
SonicParanoid 1 1.000 - - X2801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.