DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and Rab7b

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001102798.1 Gene:Rab7b / 501854 RGDID:1562617 Length:199 Species:Rattus norvegicus


Alignment Length:208 Identity:75/208 - (36%)
Similarity:119/208 - (57%) Gaps:14/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQ 71
            |:|...||::|:|..||||::||.::|...:.|....|:|...::|.|::|.....||||||.||
  Rat     3 PRKKVDLKLIIVGALGVGKTSLLHQYVHKTFFEEYQTTLGASILSKIIILDDTTLKLQIWDTGGQ 67

  Fly    72 ERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQK 136
            ||||::.:.||:|||.|:|.:.:.|.:|.:.|.:||::.|......:..:|.:|:|||.|:  :.
  Rat    68 ERFRSMVSTFYKGSDGCILAFDVTDPESFEALDIWRDDVLAKIVPMEQSYPMVVLGNKIDL--ED 130

  Fly   137 RQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAF-VLGLRQWRHMECVAEAELRQHGDTIDLT- 199
            |:|..:...:||.|:.:. :.|.|:|...||..|| ||..|.....:.:||..|   .|:|.|: 
  Rat   131 RKVPQEVAHEWCKEKDMP-YFEVSAKNDINVVQAFEVLASRALLRYQGIAENHL---ADSIKLSP 191

  Fly   200 -RPIRLVQRRICC 211
             :|     |..||
  Rat   192 GQP-----RSKCC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 64/170 (38%)
Ras 14..177 CDD:278499 61/163 (37%)
Rab7bNP_001102798.1 Rab 9..169 CDD:206640 62/162 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.