DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and Rab26

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:182 Identity:70/182 - (38%)
Similarity:102/182 - (56%) Gaps:12/182 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVILGDGGVGKSALLTRFVANRYEENNF-HTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRAL 77
            ||::|||.||||::||.||...||..:.| .|:|::|.||.:||||.|..|||||||||||||::
  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSV 278

  Fly    78 RTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQKRQVSSD 142
            ...:||.:...||.|.:.::.:...:..|..|...||   |:....:::|||.|....:|||..:
  Fly   279 THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYA---QEDVVIVLIGNKADCSGSERQVKRE 340

  Fly   143 AVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQHGD 194
            ..::...|..|. .:|||:|...||..:|....||       .::...:|||
  Fly   341 DGERLGREHNVP-FMETSAKTGLNVELSFTAVARQ-------LKSRGYEHGD 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 66/164 (40%)
Ras 14..177 CDD:278499 65/163 (40%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 70/182 (38%)
RAB 214..378 CDD:197555 67/174 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.