DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and rab7a

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_957222.1 Gene:rab7a / 393902 ZFINID:ZDB-GENE-040426-1352 Length:207 Species:Danio rerio


Alignment Length:201 Identity:80/201 - (39%)
Similarity:120/201 - (59%) Gaps:16/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQE 72
            :|..||||:||||.||||::|:.::|..::......|||.:|:.|:::||....|:|||||||||
Zfish     4 RKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQE 68

  Fly    73 RFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDIPAQK 136
            ||::|...||||:|.|:|.:.:...::.|.|..||:|||..|.. |.:.|||:|:|||.|:  :.
Zfish    69 RFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDL--EN 131

  Fly   137 RQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQHGDT---IDL 198
            |||::...|.||..:....:.|||:|.|.||..||          :.:|...|:|..:.   .:.
Zfish   132 RQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAF----------QTIARNALKQETEVELYNEF 186

  Fly   199 TRPIRL 204
            ..||:|
Zfish   187 PEPIKL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 74/170 (44%)
Ras 14..177 CDD:278499 71/163 (44%)
rab7aNP_957222.1 Rab7 9..179 CDD:206655 75/181 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.