DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and Rab30

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster


Alignment Length:228 Identity:77/228 - (33%)
Similarity:110/228 - (48%) Gaps:29/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRA 76
            |.|:|::|:.||||:.|:.||....:......||||:||.|.:.|:||:..|||||||||||||:
  Fly     7 LFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQERFRS 71

  Fly    77 LRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKND-----IPAQK 136
            :...:||.:...:|.|.:..:.:...|..|..|...||:   .|...|:||||.|     ||.| 
  Fly    72 ITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYAN---SKVLKILVGNKTDRDDREIPTQ- 132

  Fly   137 RQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAF------VLGLRQWRHME-----CVAEAELR 190
                   :.:..|:|.....:|||:|.|.||...|      ::|  |.|..:     ..|.|:.:
  Fly   133 -------IGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIG--QARSKDGSSSAAAAAAQRQ 188

  Fly   191 QHGDTIDLTRPIRLVQRRICCTGGGGGGGGVGQ 223
            ..|.:|.|........:..||.|...||....|
  Fly   189 SEGSSIGLGSFSAKAAQSNCCGGLASGGSNSSQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 64/176 (36%)
Ras 14..177 CDD:278499 63/173 (36%)
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 63/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.