DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and Rab21

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:235 Identity:74/235 - (31%)
Similarity:109/235 - (46%) Gaps:37/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDI-VVDGERYTLQIWDTAGQERFRAL 77
            |.|:||:|.|||::|:.|::.:|:...:..|:...|:::.: :.||.|..|.||||||||||.||
  Fly    15 KAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHAL 79

  Fly    78 RTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQKRQVSSD 142
            ...:|||||..||.|.:.||||.:.:..|..|.......:   ...|:||||.|:..|:.....:
  Fly    80 GPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTE---IALIIVGNKTDLEEQRAVTHDE 141

  Fly   143 AVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQHGDTIDLTRPIRLVQR 207
            |:|.  |....|.::|||:|....|.:.|          |.:.:..|.|.........|:||   
  Fly   142 ALQY--ARTVGAQYVETSAKENEGVAELF----------ELLTQLMLEQLSQRQPDASPLRL--- 191

  Fly   208 RICCTGGGGGGGGVGQDAD----GDDAAMHSPGKKVFGQK 243
                         ...|.|    .||:....||... ||:
  Fly   192 -------------QNPDTDNLNNSDDSEAPDPGDPA-GQR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 60/164 (37%)
Ras 14..177 CDD:278499 60/163 (37%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 61/175 (35%)
Ras 15..177 CDD:278499 61/176 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.