DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and Rab5

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:178 Identity:63/178 - (35%)
Similarity:94/178 - (52%) Gaps:15/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TNMRP----PQKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYT 62
            |..||    ..||...|:|:||:..||||:|:.|||..::.|....|||..|:.:.|.::.....
  Fly    15 TAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVK 79

  Fly    63 LQIWDTAGQERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVV- 126
            .:|||||||||:.:|...:|||:...::.|.:.::||.:....|..|....|.      |.||: 
  Fly    80 FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQAS------PNIVIA 138

  Fly   127 --GNKNDIPAQKRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFV 172
              |||.|: :..|.|..|..:|: ||:.....:|||:|...||.|.|:
  Fly   139 LAGNKADL-SNIRVVEFDEAKQY-AEENGLLFMETSAKTGMNVNDIFL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 60/168 (36%)
Ras 14..177 CDD:278499 58/162 (36%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 58/164 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.