DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and Rab9Fa

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_727471.1 Gene:Rab9Fa / 326230 FlyBaseID:FBgn0052671 Length:197 Species:Drosophila melanogaster


Alignment Length:177 Identity:56/177 - (31%)
Similarity:88/177 - (49%) Gaps:14/177 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERY----TLQIWDTAGQERF 74
            |::||||.||||:.||.||..|::...:..|:|::  .::..|:...:    .||:|||:..|||
  Fly     9 KIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLD--RRECSVEFADWRMGRMLQVWDTSDDERF 71

  Fly    75 RALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQKRQV 139
            :.|:....|.:...||.|.:....|.:.:..|..|.....   .||...::||||:|.| ..|||
  Fly    72 KLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLC---PDKVTVLLVGNKSDDP-NHRQV 132

  Fly   140 SSDAVQQWCAEQKVACHIETSSKAATNVTDAF---VLGLRQWRHMEC 183
            |......:...|.: |..|.|:|:..||.|.|   .:.:..:|.:.|
  Fly   133 SMAQGFNYAHRQSI-CFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHC 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 54/170 (32%)
Ras 14..177 CDD:278499 54/169 (32%)
Rab9FaNP_727471.1 RAB 8..171 CDD:197555 54/168 (32%)
Rab 8..167 CDD:206640 54/164 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.