DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and Rab27

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:234 Identity:76/234 - (32%)
Similarity:109/234 - (46%) Gaps:45/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PPQKSKLL------KVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVD--GERYT 62
            ||:...|.      :.::|||.||||:.||.::...|:......|:|::|..|.::.:  |.|:.
  Fly     5 PPEPEPLQLAGSGEQFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHR 69

  Fly    63 --LQIWDTAGQERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYA-DVDQDKFPFI 124
              |||||||||||||:|.|.|||.:...||.:.|....|......|.::...:| ..|.|   .:
  Fly    70 IHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPD---VV 131

  Fly   125 VVGNKNDIPAQKRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDA------------------- 170
            :.|||.|: .|.|.||.|.|...|...::. :||||:....||.:|                   
  Fly   132 LCGNKCDL-LQLRVVSRDQVAALCRRYRLP-YIETSACTGANVKEAVELLVGRVMERIENAACNR 194

  Fly   171 -FVLGLRQWRHMECVAEAELRQHGDTIDLTRPIRLVQRR 208
             |.|.|.|.|.:..:|      :|...||   :||..||
  Fly   195 EFSLLLTQSRCLPNIA------YGQPEDL---VRLHDRR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 64/200 (32%)
Ras 14..177 CDD:278499 63/187 (34%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 60/172 (35%)
RAB 20..186 CDD:197555 60/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.