DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and Rab7a

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_076440.1 Gene:Rab7a / 29448 RGDID:61908 Length:207 Species:Rattus norvegicus


Alignment Length:201 Identity:80/201 - (39%)
Similarity:120/201 - (59%) Gaps:16/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQE 72
            :|..||||:||||.||||::|:.::|..::......|||.:|:.|:::||....|:|||||||||
  Rat     4 RKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQE 68

  Fly    73 RFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDIPAQK 136
            ||::|...||||:|.|:|.:.:...::.|.|..||:|||..|.. |.:.|||:|:|||.|:  :.
  Rat    69 RFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDL--EN 131

  Fly   137 RQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQHGDT---IDL 198
            |||::...|.||..:....:.|||:|.|.||..||          :.:|...|:|..:.   .:.
  Rat   132 RQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAF----------QTIARNALKQETEVELYNEF 186

  Fly   199 TRPIRL 204
            ..||:|
  Rat   187 PEPIKL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 74/170 (44%)
Ras 14..177 CDD:278499 71/163 (44%)
Rab7aNP_076440.1 Rab7 9..179 CDD:206655 75/181 (41%)
Effector region. /evidence=ECO:0000250 37..45 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.