DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and ypt71

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_593524.1 Gene:ypt71 / 2543411 PomBaseID:SPAPB1A10.10c Length:208 Species:Schizosaccharomyces pombe


Alignment Length:197 Identity:81/197 - (41%)
Similarity:114/197 - (57%) Gaps:2/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQE 72
            ||...||||||||.||||:.|:.:||..::......|||.:|:.||:|||.:..|||:|||||||
pombe     4 QKRVFLKVVILGDSGVGKTCLMNQFVNQKFSREYKATIGADFLTKDVVVDDKLVTLQLWDTAGQE 68

  Fly    73 RFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQKR 137
            ||::|...||||:|.|::.|.:::..|...:..||.|||.....|:..||||:|||:.|..|.||
pombe    69 RFQSLGMAFYRGADCCVIVYNVNNSKSFDSVENWRQEFLYQTSQDECAFPFIIVGNQIDKDASKR 133

  Fly   138 QVSSDAVQQWCAEQKVA--CHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQHGDTIDLTR 200
            .||......:|..:..:  .|.|.|:|..|||||.|....|.....|...:..:....:.:.|::
pombe   134 AVSLHRALDYCKSKHGSNMIHFEASAKENTNVTDLFETVSRLALENESSRDDFVNDFSEPLLLSK 198

  Fly   201 PI 202
            |:
pombe   199 PL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 78/171 (46%)
Ras 14..177 CDD:278499 74/164 (45%)
ypt71NP_593524.1 Rab7 9..182 CDD:206655 77/172 (45%)
RAB 9..179 CDD:197555 76/169 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.