DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and rab-7

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_496549.1 Gene:rab-7 / 174834 WormBaseID:WBGene00004271 Length:209 Species:Caenorhabditis elegans


Alignment Length:195 Identity:83/195 - (42%)
Similarity:116/195 - (59%) Gaps:11/195 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MRPPQKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDT 68
            |...:|..||||:||||.||||::|:.::|..|:......|||.:|:.:|:.:|....|||||||
 Worm     1 MSGTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTLQIWDT 65

  Fly    69 AGQERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDI 132
            ||||||::|...||||:|.|:|.:.:.:..|.|.|..||:|||..|.. |.|.|||:::|||.|:
 Worm    66 AGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDL 130

  Fly   133 PAQKRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQHGDTID 197
            .:| |.|||...|.||..:....:.|.|:|.|.||..||:...|         :|..|:..:|.|
 Worm   131 ESQ-RAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIAR---------DALARESQETND 185

  Fly   198  197
             Worm   186  185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 78/170 (46%)
Ras 14..177 CDD:278499 74/163 (45%)
rab-7NP_496549.1 Rab7 10..181 CDD:206655 78/180 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S534
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.