DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9 and rab7b

DIOPT Version :9

Sequence 1:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001096381.1 Gene:rab7b / 100124979 XenbaseID:XB-GENE-5824213 Length:201 Species:Xenopus tropicalis


Alignment Length:200 Identity:76/200 - (38%)
Similarity:109/200 - (54%) Gaps:8/200 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRAL 77
            ||:.|:|..|.||::||.::|...:..:..:|:|...::|.|.:|.....||||||.||||||.|
 Frog     9 LKINIIGPMGTGKTSLLNQYVHKWFLNDYQNTLGAHLLSKTIQLDNTNLNLQIWDTGGQERFRTL 73

  Fly    78 RTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQKRQVSSD 142
            .:.||:|||.|||.:.:.|.||...|..||.:||:........||.||:|||.|:  ..||||.:
 Frog    74 VSTFYKGSDGCLLVFDVTDEDSFSCLEFWRKDFLDKIPPPIADFPMIVLGNKIDL--NDRQVSKE 136

  Fly   143 AVQQWCAEQKVACHIETSSKAATNVTDAF-VLGLRQWRHMECVAEAELRQHGDTIDLTRPIRLVQ 206
            ....||..:.|: ::|.|:|...||..|| :|..:...|.:...|:.|   |::|.| .|.....
 Frog   137 LAMSWCKGKNVS-YLEVSAKNNVNVELAFEMLSRKALIHYQESKESCL---GESIKL-YPTEDSH 196

  Fly   207 RRICC 211
            ...||
 Frog   197 SSTCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9NP_609966.1 Rab9 8..178 CDD:206697 67/165 (41%)
Ras 14..177 CDD:278499 66/163 (40%)
rab7bNP_001096381.1 Rab 9..169 CDD:206640 67/162 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.