DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CLEC6A

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001007034.1 Gene:CLEC6A / 93978 HGNCID:14556 Length:209 Species:Homo sapiens


Alignment Length:124 Identity:28/124 - (22%)
Similarity:53/124 - (42%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            ||..:|...|.::.:.|.|:.:.||.|.|:.|.:.:...|..:   .:|:...:|.....:.:|.
Human    91 YFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNES---FSYFLGLSDPQGNNNWQWI 152

  Fly   116 TNAQRISSLR-WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            .......::| |...:|:::.  |.|..:  ::.....:..||..|....||    |||
Human   153 DKTPYEKNVRFWHLGEPNHSA--EQCASI--VFWKPTGWGWNDVICETRRNS----ICE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 26/122 (21%)
CLEC6ANP_001007034.1 CLECT_DC-SIGN_like 79..204 CDD:153060 28/124 (23%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000269|PubMed:28652405, ECO:0007744|PDB:5VYB 168..170 0/1 (0%)