DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Sfp24F

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster


Alignment Length:170 Identity:58/170 - (34%)
Similarity:89/170 - (52%) Gaps:13/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVIAKTGWTR---EKFSIQVNEGNTFGAL----VKAEPFTKINDGYYFFGTE-SLNWYEAYEKCR 68
            :::..||.|.   ..|..:|:. |..|||    ...:.|.:|.:.||....: ..||:.|||.||
  Fly     1 MIVKLTGSTTFLVALFLFEVSR-NVAGALEALQTTNDTFVRIGNSYYLIERKLQKNWFGAYEICR 64

  Fly    69 ELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDN 133
            :..:||::.||..|...|:.:|.||.....|||||.||...|.|.||:|.|.:|:..|...:|:|
  Fly    65 QQQAELISLETFDELRLVSEYLLANNIFERYWTSGTDLGTKGKHVWFSNGQPLSTDLWYGGEPNN 129

  Fly   134 AGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ...:|||..||..::.::...:|||.|:.:.:    :|||
  Fly   130 KNNEEHCDELGSDFRPTKSPGMNDRNCNFESS----FICE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 44/122 (36%)
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 45/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26853
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
88.080

Return to query results.
Submit another query.