DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and si:ch211-283g2.2

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_001339584.3 Gene:si:ch211-283g2.2 / 799199 ZFINID:ZDB-GENE-060526-151 Length:521 Species:Danio rerio


Alignment Length:164 Identity:43/164 - (26%)
Similarity:62/164 - (37%) Gaps:45/164 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KTGWTREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETD 80
            |:||...|.|.                        :||....::|.||.:.|::..:.|:..:.|
Zfish   394 KSGWIVYKSSC------------------------FFFSETQVSWSEARDYCKQQEASLLKIQDD 434

  Fly    81 QEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNA-QRISSLRWARNQPD---NAG---QKE 138
            .|   ..:||..:.....||....| ..||..||.... ..|:..||.:.|||   |.|   :.|
Zfish   435 NE---EWSFLKNHTIPKHYWVGLTD-QNTGQWRWVDETPYSINKERWNQGQPDDWKNHGLGEEGE 495

  Fly   139 HCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYIC 172
            .|.|:.|..|      |||..||    :..::||
Zfish   496 DCGHISYTGK------LNDIHCS----TKIRFIC 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 38/129 (29%)
si:ch211-283g2.2XP_001339584.3 mycoplas_twoTM 132..>246 CDD:275320
CLECT_DC-SIGN_like 393..519 CDD:153060 41/162 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.