DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and asgr1c.1

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_001339584.3 Gene:asgr1c.1 / 799199 ZFINID:ZDB-GENE-060526-151 Length:521 Species:Danio rerio


Alignment Length:164 Identity:43/164 - (26%)
Similarity:62/164 - (37%) Gaps:45/164 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KTGWTREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETD 80
            |:||...|.|.                        :||....::|.||.:.|::..:.|:..:.|
Zfish   394 KSGWIVYKSSC------------------------FFFSETQVSWSEARDYCKQQEASLLKIQDD 434

  Fly    81 QEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNA-QRISSLRWARNQPD---NAG---QKE 138
            .|   ..:||..:.....||....| ..||..||.... ..|:..||.:.|||   |.|   :.|
Zfish   435 NE---EWSFLKNHTIPKHYWVGLTD-QNTGQWRWVDETPYSINKERWNQGQPDDWKNHGLGEEGE 495

  Fly   139 HCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYIC 172
            .|.|:.|..|      |||..||    :..::||
Zfish   496 DCGHISYTGK------LNDIHCS----TKIRFIC 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 38/129 (29%)
asgr1c.1XP_001339584.3 CwlO1 114..>341 CDD:443091
CLECT_DC-SIGN_like 393..519 CDD:153060 41/162 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.