DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4g

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:130 Identity:33/130 - (25%)
Similarity:50/130 - (38%) Gaps:24/130 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYW---TSGNDLAKTGS 111
            |||..|:: .|..|...|....:.||......|    ..||:.:.....||   .:...|.|...
Mouse   177 YYFSETQA-TWDTAQSYCGGQGAHLVIVRGLNE----QGFLSQHTRGRGYWLGLRAVRHLNKIQG 236

  Fly   112 HRWFTNAQRISSLRWARNQPDNAGQKEHCI---HLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            :||...|. ::...|...:|:::...|.||   |.|.         .||.||:.:.:.   :|||
Mouse   237 YRWVDGAS-LNFSHWNSGEPNDSRGHEDCIMMLHSGL---------WNDAPCTNERDG---WICE 288

  Fly   174  173
            Mouse   289  288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 30/127 (24%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003
CLECT 165..289 CDD:295302 33/130 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.