DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and SFTPA2

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_005270185.1 Gene:SFTPA2 / 729238 HGNCID:10799 Length:265 Species:Homo sapiens


Alignment Length:142 Identity:31/142 - (21%)
Similarity:55/142 - (38%) Gaps:14/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFD 84
            |...|..|:.:  |.|||........:.:..:....:|:.:....|.|......:......:|.:
Human   127 TLHDFRHQILQ--TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENE 189

  Fly    85 AVTAFLTANGSRLTYWTSG-NDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYK 148
            |:.:|:....   ||...| .:....|..| :::...::...|.|.:|...| ||.|:.:   |.
Human   190 AIASFVKKYN---TYAYVGLTEGPSPGDFR-YSDGTPVNYTNWYRGEPAGRG-KEQCVEM---YT 246

  Fly   149 DSRKFELNDRPC 160
            |.   :.|||.|
Human   247 DG---QWNDRNC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 24/111 (22%)
SFTPA2XP_005270185.1 Collagen 45..117 CDD:189968
CLECT_collectin_like 153..265 CDD:153061 24/114 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.