DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Colec11

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:127 Identity:25/127 - (19%)
Similarity:47/127 - (37%) Gaps:19/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            |....|...:.:|...|:.....| :...|:..:.:.|...|.......:...|||.|.|:..:.
Mouse   161 YLLVKEEKRYADAQLSCQARGGTL-SMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYS 224

  Fly   116 TNAQRISSLRWARNQPDNAGQKEHCIHL----GYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ..:...:..:|...:|:||..:|.|:.:    |:          ||..|    :....::||
Mouse   225 DRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGW----------NDVAC----HITMYFMCE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 23/125 (18%)
Colec11NP_001300907.1 Collagen 48..99 CDD:460189
CLECT_collectin_like 158..273 CDD:153061 25/127 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.