DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4b1

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001177239.1 Gene:Clec4b1 / 69810 MGIID:1917060 Length:209 Species:Mus musculus


Alignment Length:210 Identity:42/210 - (20%)
Similarity:82/210 - (39%) Gaps:55/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTVLLITLLVIAKTGWTREKFSIQ-----------------VNEGNTFGALVKAEPFTKINDGYY 51
            :::||::...||....|.: ||:.                 .:|||    :|..:.::.....:.
Mouse    24 ISILLLSTCFIASCVVTYQ-FSMDKPNRRLSELDRYHSLTCFSEGN----MVSDKVWSCCPKDWK 83

  Fly    52 FFGT---------ESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSR-LTYWTSGNDL 106
            .||:         .|.:|.::.|.|..:.:.||...:.:|.|.:|..|..:.:. :..|.:|   
Mouse    84 LFGSHCYLVPTVFSSASWNKSEENCSRMGAHLVVIHSQEEQDFITGILDIHAAYFIGLWDTG--- 145

  Fly   107 AKTGSHR---WFTNAQRISSLR-WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSL 167
                 ||   |........|:. |...:|.:..:|  |:.:  .|:.:..:..||..|    |..
Mouse   146 -----HRQWQWVDQTPYEESVTFWHNGEPSSDNEK--CVTV--YYRRNIGWGWNDISC----NLK 197

  Fly   168 FKYICEAPEMETISI 182
            .|.:|   :|:.|::
Mouse   198 QKSVC---QMKKINL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 28/135 (21%)
Clec4b1NP_001177239.1 CLECT_DC-SIGN_like 78..204 CDD:153060 29/144 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.