DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Cd209b

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_081248.4 Gene:Cd209b / 69165 MGIID:1916415 Length:325 Species:Mus musculus


Alignment Length:122 Identity:34/122 - (27%)
Similarity:56/122 - (45%) Gaps:14/122 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            |||.....||.:|...|:|:.::||...:|:|...:.....|.|..   |...:||.|..:..|.
Mouse   207 YFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPT---WMGLSDLKKEATWLWV 268

  Fly   116 TNAQRISSLR--WARNQPDNAGQKEHCIHL-GYIYKDS----RKF---ELNDRPCSQ 162
            ..:...|..:  |.|.:|:|.|: |.|:.. |..:.||    :||   :.:..||::
Mouse   269 DGSTLSSRFQKYWNRGEPNNIGE-EDCVEFAGDGWNDSKCELKKFWICKKSATPCTE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 34/122 (28%)
Cd209bNP_081248.4 CLECT_DC-SIGN_like 195..317 CDD:153060 32/113 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.