DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Mbl2

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_073195.2 Gene:Mbl2 / 64668 RGDID:67380 Length:244 Species:Rattus norvegicus


Alignment Length:132 Identity:34/132 - (25%)
Similarity:49/132 - (37%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAV------TAFLTANGSRLTYWTSG--NDL 106
            |:......:....|...|.||...:.|....:|..|:      .|||.....|    |..  .||
  Rat   134 YFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQR----TENVFEDL 194

  Fly   107 AKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYI 171
              ||:...:||        |...:|:|.|..|:|:    :...:.|:  ||.|||..    |..:
  Rat   195 --TGNRVRYTN--------WNEGEPNNVGSGENCV----VLLTNGKW--NDVPCSDS----FLVV 239

  Fly   172 CE 173
            ||
  Rat   240 CE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 31/129 (24%)
Mbl2NP_073195.2 Collagen 36..95 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..99
CLECT_collectin_like 132..242 CDD:153061 34/132 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.