DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and si:dkey-26c10.5

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001313501.1 Gene:si:dkey-26c10.5 / 563797 ZFINID:ZDB-GENE-060607-13 Length:265 Species:Danio rerio


Alignment Length:192 Identity:41/192 - (21%)
Similarity:74/192 - (38%) Gaps:45/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTVLLITLLVIAKTGWTREKFSIQVNEGNTFGAL-------VKAEPFTK-------INDGY---- 50
            |.::::.:|.|..||    ..|.|:.|.......       |..:||.:       ...|:    
Zfish    95 LLLIVVLVLFIKLTG----MHSCQLTETTLEQECSLKKCQEVYQQPFERALGLCRDCGSGWLRFE 155

  Fly    51 ---YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSH 112
               ||.....|.|.::.|:||....:|.....::    |..||:.. :.:.||..   |:..|::
Zfish   156 NTCYFLSETRLTWQKSREECRRKGGDLAVITNER----VQMFLSKR-AIVNYWIG---LSHVGTN 212

  Fly   113 RWFTNAQRISSLR-WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            :|......:.::| |.    |::...|..|.:|     .:..|.:.:|.|...|  .:|||:
Zfish   213 QWMWINNTVLTVRYWG----DSSSSGECGIMVG-----EKSAERSWQPASCRLN--LQYICQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 28/122 (23%)
si:dkey-26c10.5NP_001313501.1 CLECT 147..264 CDD:295302 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.