DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and zgc:194252

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001122180.1 Gene:zgc:194252 / 561367 ZFINID:ZDB-GENE-081022-86 Length:251 Species:Danio rerio


Alignment Length:83 Identity:16/83 - (19%)
Similarity:36/83 - (43%) Gaps:22/83 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTA---------------------FLTANG 94
            :||..::|:|.:|.:.||:...:|.|..: ::.:|:::                     :.|...
Zfish    24 HFFVNKTLSWQDAQKYCRQNYDDLSTVGS-KDLEALSSNPLIKEDYFWIGLQNNRNQWIWSTGEE 87

  Fly    95 SRLTYWTSGNDLAKTGSH 112
            :|:|:|..|......|.:
Zfish    88 ARVTFWDKGEPTILLGGN 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 16/83 (19%)
zgc:194252NP_001122180.1 CLECT 22..131 CDD:295302 16/83 (19%)
CLECT 128..244 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.