DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and si:ch211-225k7.6

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001093462.1 Gene:si:ch211-225k7.6 / 558654 ZFINID:ZDB-GENE-070705-121 Length:359 Species:Danio rerio


Alignment Length:136 Identity:28/136 - (20%)
Similarity:52/136 - (38%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRW--- 114
            |..:::||..|...||:.:.:||:.....|...:..|:             ||...:.|..|   
Zfish   131 FVNQTMNWRAAQSYCRQNHIDLVSVRNQNESQQLEKFI-------------NDSIPSRSDVWIGL 182

  Fly   115 -----FTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEA 174
                 :::....|...|..|:|:|.|..|:|.    :.|::......|..|    :..|.::|..
Zfish   183 FRDWQWSDQSNYSFSYWNTNEPNNYGNNENCT----VLKENTNGHWADISC----DCQFPFVCHE 239

  Fly   175 PEMETI 180
            .::..|
Zfish   240 DKLIVI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 26/127 (20%)
si:ch211-225k7.6NP_001093462.1 CLECT 23..124 CDD:470576
CLECT 127..238 CDD:470576 26/127 (20%)
CLECT 244..356 CDD:153057 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.