DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:133 Identity:34/133 - (25%)
Similarity:61/133 - (45%) Gaps:14/133 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FTKINDGYYFFGTE-SLNWYEAYEKCRELNSELVTFETDQEFDAV-TAFLTANGSRLTYWTSGND 105
            |.||...::|...: .::|::|...|.::.:.|:|.:::.|.||: |.....|.....:|...||
  Fly   145 FQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDIND 209

  Fly   106 LAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKY 170
            :||.|.............|:|.:::| .....:.|:||       |..|:.|..||:.    |.:
  Fly   210 IAKWGEFISLATGMNPPFLKWHKHRP-QVQIHQRCVHL-------RGGEMMDGKCSEQ----FLF 262

  Fly   171 ICE 173
            ||:
  Fly   263 ICQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 30/123 (24%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.