DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and lectin-30A

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:173 Identity:35/173 - (20%)
Similarity:64/173 - (36%) Gaps:33/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 REKFSIQVNE-----GN-TFGALVKAEPFTKINDG---------YYFFGTESLNWYEAYEKCREL 70
            :.|.:..:||     || :...|.|.....:||..         :|.......||:.|...||:|
  Fly    69 QSKLAYALNELQTIMGNQSVETLEKLRISHRINPALFQRMGTRRFYIEKENKQNWFGASNTCRQL 133

  Fly    71 NSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAG 135
            ...:.|...:|||:.:.:...|.    .:|...|.:.|.|........:.....:|.:   :..|
  Fly   134 GGHIATIRDEQEFNEIFSRAPAG----VFWIDMNAMFKNGLFASSLTGRSPPFFKWKK---EERG 191

  Fly   136 QKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEAPEME 178
            .|..|::   :|..    |:.:..|.    :...:||:|.:.:
  Fly   192 NKFDCVN---VYNK----EMYNENCF----NTHLFICQAEQWD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 24/121 (20%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 23/117 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.