DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and lectin-46Cb

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001163102.1 Gene:lectin-46Cb / 53522 FlyBaseID:FBgn0040092 Length:322 Species:Drosophila melanogaster


Alignment Length:124 Identity:28/124 - (22%)
Similarity:49/124 - (39%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTVLLITLLVIAKTGWTREKFSIQVNEGNTFGALVKAEP------FTKINDGYYFFGTESLNWYE 62
            ||.|:..|.::.:                  |.|:.:.|      ..:||...|:|..:.:||:.
  Fly     5 LTALVALLSILPR------------------GELLGSGPPCPRRYLRRINGKCYYFSVKKMNWFG 51

  Fly    63 AYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRI 121
            |...|......|......::||....||:..|:...:|..||||...|..::.:|.:.:
  Fly    52 ALNNCLRKGLTLADLSNQRDFDGAIGFLSGLGNTEDFWFGGNDLYHEGRFQYISNGRLV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 19/71 (27%)
lectin-46CbNP_001163102.1 CLECT 38..155 CDD:153057 19/73 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.