DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4f

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:72/169 - (42%) Gaps:29/169 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KTGWTREKFSIQVNEGNTFGALVK--AEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFE 78
            :.|..:|..:.|..|..|...:::  |:.:...|..:|:|..:...|.||.:.|....:.|.:..
Mouse   387 RLGALQEAVAAQKQEQKTQNQVLQLIAQNWKYFNGNFYYFSRDKKPWREAEKFCTSQGAHLASVT 451

  Fly    79 TDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRW-----FTNAQRISSLRWARNQPDN----A 134
            :.:|    .|||....|...:|....|....|..||     |.|||  |...|.:|||||    .
Mouse   452 SQEE----QAFLVQTTSSGDHWIGLTDQGTEGIWRWVDGTPFNNAQ--SKGFWGKNQPDNWRHRN 510

  Fly   135 GQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            |::|.|:|:        :.:.||..|    .|.:.::|:
Mouse   511 GEREDCVHV--------RQQWNDMAC----GSSYPWVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 36/130 (28%)
Clec4fNP_058031.2 PhageMin_Tail 144..411 CDD:304511 5/23 (22%)
MscS_porin 222..415 CDD:289559 6/27 (22%)
CLECT_DC-SIGN_like 414..538 CDD:153060 38/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11565
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.